PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012608.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 238aa    MW: 26859.8 Da    PI: 7.7644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012608.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.5e-092365344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     rWT eEd+++ +a + ++ +   +W +Ia+++   +++ ++k+++
      CCG012608.2 23 RWTREEDKIFEQALTIFPENlpdRWQSIANHIR--KSAWEVKEHY 65
                     9*******************************8..89999**998 PP

2Myb_DNA-binding43.19.9e-14134178347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
      CCG012608.2 134 PWTEDEHKLFLVGLSKFGKGDWRSISRNVVITRTPTQVASHAQKY 178
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.4E-82071IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-42268IPR009057Homeodomain-like
PfamPF002494.3E-62365IPR001005SANT/Myb domain
SuperFamilySSF466891.1E-122377IPR009057Homeodomain-like
CDDcd001678.03E-82365No hitNo description
PROSITE profilePS500906.7022369IPR017877Myb-like domain
PROSITE profilePS5129418.415127183IPR017930Myb domain
SuperFamilySSF466891.45E-16128184IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-17130182IPR006447Myb domain, plants
SMARTSM007173.2E-11131181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-10131177IPR009057Homeodomain-like
PfamPF002491.5E-12134178IPR001005SANT/Myb domain
CDDcd001672.81E-9134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MHQDFSFQTR CLTQSPHATA ATRWTREEDK IFEQALTIFP ENLPDRWQSI ANHIRKSAWE  60
VKEHYDILVH DVLAIDSGRV ELPTYRDDES VSWESSGGDG DGAGRMVAAR APPSGQICFG  120
GKAKQDTERK KGTPWTEDEH KLFLVGLSKF GKGDWRSISR NVVITRTPTQ VASHAQKYFL  180
RQNSVKKERK RSSIHDITSV DNNTVGPSAD DHWNSPPGPP TNQDGPPGLG YQNFRFQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1324861174RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024174.11e-180PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9HVV51e-168B9HVV5_POPTR; Uncharacterized protein
STRINGPOPTR_0010s24710.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-78MYB family protein